Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045419 ID=TCONS_00045419|Name=TCONS_00045419|organism=Clytia hemisphaerica|type=transcript|length=269bpRun BLAST on NCBI transcript from alignment at sc0007769:1..738+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045419 ID=TCONS_00045419|Name=TCONS_00045419|organism=Clytia hemisphaerica|type=transcript|length=738bp|location=Sequence derived from alignment at sc0007769:1..738+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045419 vs. Swiss-Prot (Human)
Match: GRK6 (G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2) HSP 1 Score: 109.383 bits (272), Expect = 6.345e-29 Identity = 64/81 (79.01%), Postives = 73/81 (90.12%), Query Frame = 3 Query: 3 RYLQWKSLERMPVSKNLFRHYRVLGKGGFGEVCACQSRATGQMYAMXXXXXXXXXXXXXXXMALNEKQLLERIDCRFIVSI 245 R+LQWK LER PV+KN FR YRVLGKGGFGEVCACQ RATG+MYA KKLEKKRIKKRKGE MALNEKQ+LE+++ RF+VS+ Sbjct: 169 RFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSL 249 The following BLAST results are available for this feature:
BLAST of TCONS_00045419 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|