Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00017192-protein ID=TCONS_00017192-protein|Name=TCONS_00017192-protein|organism=Clytia hemisphaerica|type=polypeptide|length=169bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00017192-protein vs. Swiss-Prot (Human)
Match: BL1S2 (Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens GN=BLOC1S2 PE=1 SV=1) HSP 1 Score: 114.775 bits (286), Expect = 3.084e-33 Identity = 54/103 (52.43%), Postives = 73/103 (70.87%), Query Frame = 0 Query: 50 ESCDNMVDKITDYLNGELAATSADYKLLENLNKMATEKYTDMSKTTNNLITNMDDINERYKALAPYLQQIDLLEESVLKLEQTAYKLDSYSKQLETKFKTMER 152 E C +M K+ YL GEL ATS DYKLLEN+NK+ + KY +M N+ N+ D+N++Y L PYL QI+++EE V LEQ AYKLD+YSK+LE K+K +E+ Sbjct: 39 ELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEK 141 The following BLAST results are available for this feature:
BLAST of TCONS_00017192-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|