Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00021907-protein ID=TCONS_00021907-protein|Name=TCONS_00021907-protein|organism=Clytia hemisphaerica|type=polypeptide|length=292bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00021907-protein vs. Swiss-Prot (Human)
Match: NF2L1 (Nuclear factor erythroid 2-related factor 1 OS=Homo sapiens GN=NFE2L1 PE=1 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 3.980e-19 Identity = 46/129 (35.66%), Postives = 79/129 (61.24%), Query Frame = 0 Query: 153 FPYTRDQIGRMPVSKFNDLI--LQLDEMRVHVARDIRRKFKNKIAARNCRKRKIQQIDHLDTGLESLESNLHKLQTENKDLKKDIADLTNKLSWFDQQIFDQLKDRDAIPSFSEKTHSLWYANDKVFLV 279 P+T D+I +PV +FN+L+ QL E ++ + RDIRR+ KNK+AA+NCRKRK+ I +L+ +E L+ + +L E + + + + K+ Q++F +L+D + P +S ++L YA D L+ Sbjct: 623 IPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRP-YSPSQYALQYAGDGSVLL 750 The following BLAST results are available for this feature:
BLAST of TCONS_00021907-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|